SCOPe 2.03: Domain d1su4a1: 1su4 A:125-239

Lineage for d1su4a1 (1su4 A:125-239)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family)
   a distorted variant of double-helix

5. Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)

6. Protein Calcium ATPase, transduction domain A [81651] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (37 PDB entries)
   Uniprot P04191

8. Domain d1su4a1: 1su4 A:125-239 [98993]
   Other proteins in same PDB: d1su4a2, d1su4a3, d1su4a4
   complexed with ca, na

Details for d1su4a1

PDB Entry: 1su4, 2.4 Å

PDB Description: crystal structure of calcium atpase with two bound calcium ions

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d1su4a1:

Sequence; same for both SEQRES and ATOM records:

>d1su4a1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

Timeline for d1su4a1:

• d1su4a1 first appeared in SCOP 1.67
  
• d1su4a1 appears in SCOPe 2.02
  
• d1su4a1 appears in SCOPe 2.04
  
• d1su4a1 appears in the current release, SCOPe 2.08