Lineage for d1su4a1 (1su4 A:125-239)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1138044Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1139304Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 1139305Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein)
  6. 1139306Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 1139307Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (14 PDB entries)
    Uniprot P04191
  8. 1139315Domain d1su4a1: 1su4 A:125-239 [98993]
    Other proteins in same PDB: d1su4a2, d1su4a3, d1su4a4
    complexed with ca, na

Details for d1su4a1

PDB Entry: 1su4 (more details), 2.4 Å

PDB Description: crystal structure of calcium atpase with two bound calcium ions
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d1su4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1su4a1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOPe Domain Coordinates for d1su4a1:

Click to download the PDB-style file with coordinates for d1su4a1.
(The format of our PDB-style files is described here.)

Timeline for d1su4a1: