![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) ![]() |
![]() | Family c.52.1.2: Restriction endonuclease EcoRV [52984] (1 protein) |
![]() | Protein Restriction endonuclease EcoRV [52985] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [52986] (29 PDB entries) |
![]() | Domain d1stxb_: 1stx B: [98990] protein/DNA complex; complexed with mn; mutant |
PDB Entry: 1stx (more details), 2.1 Å
SCOPe Domain Sequences for d1stxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1stxb_ c.52.1.2 (B:) Restriction endonuclease EcoRV {Escherichia coli [TaxId: 562]} slrsdlinalydenqkydvcgiisaegkiyplgsdtavlstifelfsrpiinkiaekhgy iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy rgrk
Timeline for d1stxb_: