Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) |
Family c.50.1.2: Macro domain [89724] (7 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
Protein Hypothetical protein YmbD [102530] (1 species) |
Species Escherichia coli [TaxId:562] [102531] (1 PDB entry) |
Domain d1spva_: 1spv A: [98957] structural genomics; NESG target ER58 complexed with mes |
PDB Entry: 1spv (more details), 2 Å
SCOPe Domain Sequences for d1spva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1spva_ c.50.1.2 (A:) Hypothetical protein YmbD {Escherichia coli [TaxId: 562]} trihvvqgditklavdvivnaanpslmggggvdgaihraagpalldaclkvrqqqgdcpt ghavitlagdlpakavvhtvgpvwrggeqnedqllqdaylnslrlvaansytsvafpais tgvygypraaaaeiavktvsefitrhalpeqvyfvcydeenahlyerlltqq
Timeline for d1spva_: