SCOP 1.75: Domain d1so0c_: 1so0 C:

Lineage for d1so0c_ (1so0 C:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 proteins)

6. Protein Galactose mutarotase [74912] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101659] (2 PDB entries)

8. Domain d1so0c_: 1so0 C: [98934]

Details for d1so0c_

PDB Entry: 1so0, 2.3 Å

PDB Description: crystal structure of human galactose mutarotase complexed with galactose

PDB Compounds: (C:) aldose 1-epimerase

SCOP Domain Sequences for d1so0c_:

Sequence; same for both SEQRES and ATOM records:

>d1so0c_ b.30.5.4 (C:) Galactose mutarotase {Human (Homo sapiens) [TaxId: 9606]}
ghmasvtravfgelpsgggtvekfqlqsdllrvdiiswgctitalevkdrqgrasdvvlg
faelegylqkqpyfgavigrvanriakgtfkvdgkeyhlainkepnslhggvrgfdkvlw
tprvlsngvqfsrispdgeegypgelkvwvtytldggelivnyraqasqatpvnltnhsy
fnlagqaspnindhevtieadtylpvdetliptgevapvqgtafdlrkpvelgkhlqdfh
lngfdhnfclkgskekhfcarvhhaasgrvlevyttqpgvqfytgnfldgtlkgkngavy
pkhsgfcletqnwpdavnqprfppvllrpgeeydhttwfkfsva

Timeline for d1so0c_:

• d1so0c_ first appeared in SCOP 1.67
  
• d1so0c_ appears in SCOP 1.73
  
• d1so0c_ appears in SCOPe 2.01
  
• d1so0c_ appears in the current release, SCOPe 2.08, called d1so0c1