Lineage for d1so0c1 (1so0 C:1-342)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2375752Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2375891Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2376159Family b.30.5.4: Aldose 1-epimerase (mutarotase) [74911] (2 protein domains)
    automatically mapped to Pfam PF01263
  6. 2376164Protein Galactose mutarotase [74912] (3 species)
  7. 2376167Species Human (Homo sapiens) [TaxId:9606] [101659] (2 PDB entries)
  8. 2376172Domain d1so0c1: 1so0 C:1-342 [98934]
    Other proteins in same PDB: d1so0a2, d1so0c2
    complexed with gal

Details for d1so0c1

PDB Entry: 1so0 (more details), 2.3 Å

PDB Description: crystal structure of human galactose mutarotase complexed with galactose
PDB Compounds: (C:) aldose 1-epimerase

SCOPe Domain Sequences for d1so0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1so0c1 b.30.5.4 (C:1-342) Galactose mutarotase {Human (Homo sapiens) [TaxId: 9606]}
masvtravfgelpsgggtvekfqlqsdllrvdiiswgctitalevkdrqgrasdvvlgfa
elegylqkqpyfgavigrvanriakgtfkvdgkeyhlainkepnslhggvrgfdkvlwtp
rvlsngvqfsrispdgeegypgelkvwvtytldggelivnyraqasqatpvnltnhsyfn
lagqaspnindhevtieadtylpvdetliptgevapvqgtafdlrkpvelgkhlqdfhln
gfdhnfclkgskekhfcarvhhaasgrvlevyttqpgvqfytgnfldgtlkgkngavypk
hsgfcletqnwpdavnqprfppvllrpgeeydhttwfkfsva

SCOPe Domain Coordinates for d1so0c1:

Click to download the PDB-style file with coordinates for d1so0c1.
(The format of our PDB-style files is described here.)

Timeline for d1so0c1: