Lineage for d1smcb_ (1smc B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332308Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1332444Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1332445Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1332515Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (7 species)
  7. 1332558Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (8 PDB entries)
  8. 1332568Domain d1smcb_: 1smc B: [98921]
    complexed with dut, no3, trs

Details for d1smcb_

PDB Entry: 1smc (more details), 2.1 Å

PDB Description: Mycobacterium tuberculosis dUTPase complexed with dUTP in the absence of metal ion.
PDB Compounds: (B:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d1smcb_:

Sequence, based on SEQRES records: (download)

>d1smcb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
hmsttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvg
lvhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrv
elvelvevssfdeaglastsr

Sequence, based on observed residues (ATOM records): (download)

>d1smcb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
hmsttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvg
lvhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrv
elvelvevssfdeaglar

SCOPe Domain Coordinates for d1smcb_:

Click to download the PDB-style file with coordinates for d1smcb_.
(The format of our PDB-style files is described here.)

Timeline for d1smcb_: