SCOP 1.67: Domain d1smcb_: 1smc B:

Lineage for d1smcb_ (1smc B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (2 proteins)

6. Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (5 species)

7. Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (7 PDB entries)

8. Domain d1smcb_: 1smc B: [98921]

Details for d1smcb_

PDB Entry: 1smc, 2.1 Å

PDB Description: Mycobacterium tuberculosis dUTPase complexed with dUTP in the absence of metal ion.

SCOP Domain Sequences for d1smcb_:

Sequence, based on SEQRES records:

>d1smcb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c}
hmsttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvg
lvhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrv
elvelvevssfdeaglastsr

Sequence, based on observed residues (ATOM records):

>d1smcb_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c}
hmsttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvg
lvhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrv
elvelvevssfdeaglar

Timeline for d1smcb_:

• d1smcb_ is new in SCOP 1.67
  
• d1smcb_ appears in SCOP 1.69
  
• d1smcb_ appears in the current release, SCOPe 2.08, called d1smcb1