Lineage for d1sm8c_ (1sm8 C:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678386Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 678502Superfamily b.85.4: dUTPase-like [51283] (1 family) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 678503Family b.85.4.1: dUTPase-like [51284] (4 proteins)
  6. 678534Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (6 species)
  7. 678573Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (8 PDB entries)
  8. 678591Domain d1sm8c_: 1sm8 C: [98919]
    complexed with cr, dut, no3, trs

Details for d1sm8c_

PDB Entry: 1sm8 (more details), 2.9 Å

PDB Description: M. tuberculosis dUTPase complexed with chromium and dUTP
PDB Compounds: (C:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOP Domain Sequences for d1sm8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sm8c_ b.85.4.1 (C:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c [TaxId: 1773]}
sttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvglv
hprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrvel
velvevssf

SCOP Domain Coordinates for d1sm8c_:

Click to download the PDB-style file with coordinates for d1sm8c_.
(The format of our PDB-style files is described here.)

Timeline for d1sm8c_: