Class b: All beta proteins [48724] (149 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (1 family) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (3 proteins) |
Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (5 species) |
Species Mycobacterium tuberculosis, rv2697c [TaxId:1773] [82213] (7 PDB entries) |
Domain d1sm8c_: 1sm8 C: [98919] complexed with cr, dut, no3, trs |
PDB Entry: 1sm8 (more details), 2.9 Å
SCOP Domain Sequences for d1sm8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sm8c_ b.85.4.1 (C:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Mycobacterium tuberculosis, rv2697c} sttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvavavpfgmvglv hprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdriaqllvqrvel velvevssf
Timeline for d1sm8c_: