Lineage for d1sg3b2 (1sg3 B:195-343)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774848Family b.18.1.22: Allantoicase repeat [101588] (1 protein)
    automatically mapped to Pfam PF03561
  6. 2774849Protein Allantoicase [101589] (1 species)
    duplication: tandem repeat of two similar domains
  7. 2774850Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101590] (2 PDB entries)
    Yir029w
  8. 2774856Domain d1sg3b2: 1sg3 B:195-343 [98850]
    Other proteins in same PDB: d1sg3b3

Details for d1sg3b2

PDB Entry: 1sg3 (more details), 2.6 Å

PDB Description: structure of allantoicase
PDB Compounds: (B:) Allantoicase

SCOPe Domain Sequences for d1sg3b2:

Sequence, based on SEQRES records: (download)

>d1sg3b2 b.18.1.22 (B:195-343) Allantoicase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
iidlayvcngavalkysdqhfgsvdnlllpgrghdmsdgwetkrsrqpghtdwaviqlgr
essfiekiivdtahfrgnfpqfitvegclkesessentgegtwvelvgksktgpdkehvy
eirksirvshvkltiipdggvkrirvwgy

Sequence, based on observed residues (ATOM records): (download)

>d1sg3b2 b.18.1.22 (B:195-343) Allantoicase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
iidlayvcngavalkysdqhfgsvdnlllpgrghdmsdgwetkrsrqpghtdwaviqlgr
essfiekiivdtahfrgnfpqfitvegclktwvelvgksktgpdkehvyeirksirvshv
kltiipdggvkrirvwgy

SCOPe Domain Coordinates for d1sg3b2:

Click to download the PDB-style file with coordinates for d1sg3b2.
(The format of our PDB-style files is described here.)

Timeline for d1sg3b2: