Lineage for d1scza_ (1scz A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1599449Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 1599450Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) (S)
  5. 1599451Family c.43.1.1: CAT-like [52778] (3 proteins)
    trimeric enzymes with the active sites being located in between subunits
  6. 1599521Protein Dihydrolipoamide succinyltransferase [52785] (1 species)
  7. 1599522Species Escherichia coli [TaxId:562] [52786] (3 PDB entries)
  8. 1599523Domain d1scza_: 1scz A: [98802]

Details for d1scza_

PDB Entry: 1scz (more details), 2.2 Å

PDB Description: improved structural model for the catalytic domain of e.coli dihydrolipoamide succinyltransferase
PDB Compounds: (A:) dihydrolipoamide succinyltransferase

SCOPe Domain Sequences for d1scza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scza_ c.43.1.1 (A:) Dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]}
arsekrvpmtrlrkrvaerlleaknstamlttfnevnmkpimdlrkqygeafekrhgirl
gfmsfyvkavvealkrypevnasidgddvvyhnyfdvsmavstprglvtpvlrdvdtlgm
adiekkikelavkgrdgkltvedltggnftitnggvfgslmstpiinppqsailgmhaik
drpmavngqveilpmmylalsydhrlidgresvgflvtikelledptrllldv

SCOPe Domain Coordinates for d1scza_:

Click to download the PDB-style file with coordinates for d1scza_.
(The format of our PDB-style files is described here.)

Timeline for d1scza_: