Lineage for d1sc5a1 (1sc5 A:87-163)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1081117Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 1081118Family a.4.13.1: Sigma3 domain [88660] (3 proteins)
  6. 1081123Protein Sigma factor sigma-28 (FliA) [101055] (1 species)
  7. 1081124Species Aquifex aeolicus [TaxId:63363] [101056] (2 PDB entries)
  8. 1081129Domain d1sc5a1: 1sc5 A:87-163 [98798]
    Other proteins in same PDB: d1sc5a2, d1sc5a3, d1sc5b_
    protein/RNA complex

Details for d1sc5a1

PDB Entry: 1sc5 (more details), 3.26 Å

PDB Description: Sigma-28(FliA)/FlgM complex
PDB Compounds: (A:) RNA polymerase sigma factor FliA

SCOPe Domain Sequences for d1sc5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sc5a1 a.4.13.1 (A:87-163) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]}
gsrqvrekerrikevveklkeklgreptdeevakelgisteelfktldkinfsyilslee
vfrdfardyselipsst

SCOPe Domain Coordinates for d1sc5a1:

Click to download the PDB-style file with coordinates for d1sc5a1.
(The format of our PDB-style files is described here.)

Timeline for d1sc5a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sc5b_