| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) ![]() |
| Family a.4.13.1: Sigma3 domain [88660] (3 proteins) |
| Protein Sigma factor sigma-28 (FliA) [101055] (1 species) |
| Species Aquifex aeolicus [TaxId:63363] [101056] (2 PDB entries) |
| Domain d1sc5a1: 1sc5 A:87-163 [98798] Other proteins in same PDB: d1sc5a2, d1sc5a3, d1sc5b_ protein/RNA complex |
PDB Entry: 1sc5 (more details), 3.26 Å
SCOPe Domain Sequences for d1sc5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sc5a1 a.4.13.1 (A:87-163) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]}
gsrqvrekerrikevveklkeklgreptdeevakelgisteelfktldkinfsyilslee
vfrdfardyselipsst
Timeline for d1sc5a1: