Lineage for d1sc0a_ (1sc0 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023831Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1023832Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1024054Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 1024066Protein Hypothetical protein HI1161 [89905] (1 species)
  7. 1024067Species Haemophilus influenzae [TaxId:727] [89906] (2 PDB entries)
  8. 1024072Domain d1sc0a_: 1sc0 A: [98796]
    structural genomics; NESG target IR63

Details for d1sc0a_

PDB Entry: 1sc0 (more details)

PDB Description: X-ray Structure of YB61_HAEIN Northeast Structural Genomics Consortium Target IR63
PDB Compounds: (A:) Hypothetical protein HI1161

SCOPe Domain Sequences for d1sc0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sc0a_ d.38.1.5 (A:) Hypothetical protein HI1161 {Haemophilus influenzae [TaxId: 727]}
lwkktftlenlnqlcsnsavshlgieisafgedwieatmpvdhrtmqpfgvlhggvsval
aetigslagslcleegktvvgldinanhlrpvrsgkvtaratpinlgrniqvwqidirte
enklccvsrltlsvinl

SCOPe Domain Coordinates for d1sc0a_:

Click to download the PDB-style file with coordinates for d1sc0a_.
(The format of our PDB-style files is described here.)

Timeline for d1sc0a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sc0b_