Lineage for d1sb0a_ (1sb0 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986157Fold a.12: Kix domain of CBP (creb binding protein) [47039] (1 superfamily)
    3 helices; bundle, partly opened
  4. 1986158Superfamily a.12.1: Kix domain of CBP (creb binding protein) [47040] (1 family) (S)
    automatically mapped to Pfam PF02172
  5. 1986159Family a.12.1.1: Kix domain of CBP (creb binding protein) [47041] (1 protein)
  6. 1986160Protein Kix domain of CBP (creb binding protein) [47042] (1 species)
  7. 1986161Species Mouse (Mus musculus) [TaxId:10090] [47043] (10 PDB entries)
  8. 1986165Domain d1sb0a_: 1sb0 A: [98789]
    complexed with the transactivation peptide of c-myb, chain B

Details for d1sb0a_

PDB Entry: 1sb0 (more details)

PDB Description: Solution structure of the KIX domain of CBP bound to the transactivation domain of c-Myb
PDB Compounds: (A:) protein CBP

SCOPe Domain Sequences for d1sb0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sb0a_ a.12.1.1 (A:) Kix domain of CBP (creb binding protein) {Mouse (Mus musculus) [TaxId: 10090]}
gvrkgwhehvtqdlrshlvhklvqaifptpdpaalkdrrmenlvayakkvegdmyesans
rdeyyhllaekiykiqkeleekrrsrl

SCOPe Domain Coordinates for d1sb0a_:

Click to download the PDB-style file with coordinates for d1sb0a_.
(The format of our PDB-style files is described here.)

Timeline for d1sb0a_: