SCOP 1.67: Domain d1s8oa1: 1s8o A:4-225

Lineage for d1s8oa1 (1s8o A:4-225)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (14 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.2: Epoxide hydrolase, N-terminal domain [56789] (1 protein)
   the insertion subdomain is a 4-helical bundle

6. Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
   has a lipid phosphatase activity

7. Species Human (Homo sapiens) [TaxId:9606] [102303] (2 PDB entries)

8. Domain d1s8oa1: 1s8o A:4-225 [98736]
   Other proteins in same PDB: d1s8oa2
   complexed with p6g

Details for d1s8oa1

PDB Entry: 1s8o, 2.6 Å

PDB Description: Human soluble Epoxide Hydrolase

SCOP Domain Sequences for d1s8oa1:

Sequence; same for both SEQRES and ATOM records:

>d1s8oa1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens)}
raavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitlsqw
iplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttailt
ntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevvfl
ddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntp

Timeline for d1s8oa1:

• d1s8oa1 is new in SCOP 1.67
  
• d1s8oa1 appears in SCOP 1.69
  
• d1s8oa1 appears in the current release, SCOPe 2.08