Lineage for d1s8oa1 (1s8o A:4-225)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 404418Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 404419Superfamily c.108.1: HAD-like [56784] (14 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 404436Family c.108.1.2: Epoxide hydrolase, N-terminal domain [56789] (1 protein)
    the insertion subdomain is a 4-helical bundle
  6. 404437Protein Epoxide hydrolase, N-terminal domain [56790] (2 species)
    has a lipid phosphatase activity
  7. 404438Species Human (Homo sapiens) [TaxId:9606] [102303] (2 PDB entries)
  8. 404440Domain d1s8oa1: 1s8o A:4-225 [98736]
    Other proteins in same PDB: d1s8oa2
    complexed with p6g

Details for d1s8oa1

PDB Entry: 1s8o (more details), 2.6 Å

PDB Description: Human soluble Epoxide Hydrolase

SCOP Domain Sequences for d1s8oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s8oa1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens)}
raavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitlsqw
iplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttailt
ntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevvfl
ddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntp

SCOP Domain Coordinates for d1s8oa1:

Click to download the PDB-style file with coordinates for d1s8oa1.
(The format of our PDB-style files is described here.)

Timeline for d1s8oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s8oa2