Lineage for d1s89a_ (1s89 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467829Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2467830Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2467874Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins)
  6. 2467875Protein Methylglyoxal synthase, MgsA [52340] (3 species)
  7. 2467876Species Escherichia coli [TaxId:562] [52341] (5 PDB entries)
  8. 2467898Domain d1s89a_: 1s89 A: [98721]
    complexed with pga; mutant

Details for d1s89a_

PDB Entry: 1s89 (more details), 2.22 Å

PDB Description: h98n mutant of methylglyoxal synthase from e. coli complexed with phosphoglycolic acid
PDB Compounds: (A:) methylglyoxal synthase

SCOPe Domain Sequences for d1s89a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s89a_ c.24.1.2 (A:) Methylglyoxal synthase, MgsA {Escherichia coli [TaxId: 562]}
melttrtlparkhialvahdhckqmlmswverhqplleqhvlyatgttgnlisratgmnv
namlsgpmggdqqvgalisegkidvliffwdplnavpndpdvkallrlatvwnipvatnv
atadfiiqsphfndavdilipdyqryladrlk

SCOPe Domain Coordinates for d1s89a_:

Click to download the PDB-style file with coordinates for d1s89a_.
(The format of our PDB-style files is described here.)

Timeline for d1s89a_: