Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins) silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain |
Protein AF0112, Sir2 homolog (Sir2-AF2) [82380] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [82381] (3 PDB entries) |
Domain d1s7gc_: 1s7g C: [98644] complexed with 1pe, 2pe, apr, edo, nad, p6g, pg4, so4, zn |
PDB Entry: 1s7g (more details), 2.3 Å
SCOPe Domain Sequences for d1s7gc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s7gc_ c.31.1.5 (C:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeoglobus fulgidus [TaxId: 2234]} medeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnp rafwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgs mdkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaiee akhcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlp kiveevkrlrse
Timeline for d1s7gc_:
View in 3D Domains from other chains: (mouse over for more information) d1s7ga_, d1s7gb_, d1s7gd_, d1s7ge_ |