SCOPe 2.06: Domain d1s7gc_: 1s7g C:

Lineage for d1s7gc_ (1s7g C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins)
   silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain

6. Protein AF0112, Sir2 homolog (Sir2-AF2) [82380] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [82381] (3 PDB entries)

8. Domain d1s7gc_: 1s7g C: [98644]
   complexed with 1pe, 2pe, apr, edo, nad, p6g, pg4, so4, zn

Details for d1s7gc_

PDB Entry: 1s7g, 2.3 Å

PDB Description: Structural Basis for the Mechanism and Regulation of Sir2 Enzymes

PDB Compounds: (C:) NAD-dependent deacetylase 2

SCOPe Domain Sequences for d1s7gc_:

Sequence; same for both SEQRES and ATOM records:

>d1s7gc_ c.31.1.5 (C:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeoglobus fulgidus [TaxId: 2234]}
medeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnp
rafwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgs
mdkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaiee
akhcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlp
kiveevkrlrse

Timeline for d1s7gc_:

• d1s7gc_ first appeared in SCOP 1.67
  
• d1s7gc_ appears in SCOPe 2.05
  
• d1s7gc_ appears in SCOPe 2.07
  
• d1s7gc_ appears in the current release, SCOPe 2.08