Lineage for d1s79a_ (1s79 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724387Protein Lupus LA protein [89940] (1 species)
  7. 724388Species Human (Homo sapiens) [TaxId:9606] [89941] (4 PDB entries)
  8. 724393Domain d1s79a_: 1s79 A: [98632]
    central RBD

Details for d1s79a_

PDB Entry: 1s79 (more details)

PDB Description: solution structure of the central rrm of human la protein
PDB Compounds: (A:) Lupus La protein

SCOP Domain Sequences for d1s79a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s79a_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}
grwilkndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfd
siesakkfvetpgqkyketdllilfkddyfakkneerkqnkve

SCOP Domain Coordinates for d1s79a_:

Click to download the PDB-style file with coordinates for d1s79a_.
(The format of our PDB-style files is described here.)

Timeline for d1s79a_: