![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
![]() | Domain d1s78d2: 1s78 D:114-216 [98627] Other proteins in same PDB: d1s78a1, d1s78a2, d1s78a3, d1s78a4, d1s78b1, d1s78b2, d1s78b3, d1s78b4, d1s78c1, d1s78c2, d1s78d1, d1s78e1, d1s78e2, d1s78f1 |
PDB Entry: 1s78 (more details), 3.25 Å
SCOP Domain Sequences for d1s78d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s78d2 b.1.1.2 (D:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d1s78d2: