Lineage for d1s5uf_ (1s5u F:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410666Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 410667Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families) (S)
  5. 410668Family d.38.1.1: 4HBT-like [54638] (4 proteins)
  6. 410681Protein Hypothetical protein YbgC [102901] (1 species)
  7. 410682Species Escherichia coli [TaxId:562] [102902] (1 PDB entry)
  8. 410688Domain d1s5uf_: 1s5u F: [98578]

Details for d1s5uf_

PDB Entry: 1s5u (more details), 1.7 Å

PDB Description: Crystal Structure of Hypothetical Protein EC709 from Escherichia coli

SCOP Domain Sequences for d1s5uf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5uf_ d.38.1.1 (F:) Hypothetical protein YbgC {Escherichia coli}
tlfrwpvrvyyedtdaggvvyhasyvafyerartemlrhhhfsqqalmaervafvvrkmt
veyyaparlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdplkmkpra
lpksivaefk

SCOP Domain Coordinates for d1s5uf_:

Click to download the PDB-style file with coordinates for d1s5uf_.
(The format of our PDB-style files is described here.)

Timeline for d1s5uf_: