Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.1: 4HBT-like [54638] (19 proteins) Pfam PF03061 |
Protein Hypothetical protein YbgC [102901] (1 species) |
Species Escherichia coli [TaxId:562] [102902] (1 PDB entry) |
Domain d1s5ue_: 1s5u E: [98577] structural genomics complexed with edo, so4 |
PDB Entry: 1s5u (more details), 1.7 Å
SCOPe Domain Sequences for d1s5ue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s5ue_ d.38.1.1 (E:) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]} ghmnttlfrwpvrvyyedtdaggvvyhasyvafyerartemlrhhhfsqqalmaervafv vrkmtveyyaparlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdplk mkpralpksivaefkq
Timeline for d1s5ue_: