SCOPe 2.08: Domain d1s5ue1: 1s5u E:1-134

Lineage for d1s5ue1 (1s5u E:1-134)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein Hypothetical protein YbgC [102901] (1 species)

7. Species Escherichia coli [TaxId:562] [102902] (1 PDB entry)

8. Domain d1s5ue1: 1s5u E:1-134 [98577]
   Other proteins in same PDB: d1s5ue2
   structural genomics
   complexed with edo, so4

Details for d1s5ue1

PDB Entry: 1s5u, 1.7 Å

PDB Description: Crystal Structure of Hypothetical Protein EC709 from Escherichia coli

PDB Compounds: (E:) Protein ybgC

SCOPe Domain Sequences for d1s5ue1:

Sequence; same for both SEQRES and ATOM records:

>d1s5ue1 d.38.1.1 (E:1-134) Hypothetical protein YbgC {Escherichia coli [TaxId: 562]}
mnttlfrwpvrvyyedtdaggvvyhasyvafyerartemlrhhhfsqqalmaervafvvr
kmtveyyaparlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdplkmk
pralpksivaefkq

Timeline for d1s5ue1:

• d1s5ue1 first appeared in SCOP 1.67, called d1s5ue_
  
• d1s5ue1 appears in SCOPe 2.07