| Class b: All beta proteins [48724] (174 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
| Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
| Protein Cholera toxin [50208] (1 species) barrel, partly opened; n*=5, S*=10 |
| Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries) Uniprot P01556 22-124 |
| Domain d1s5en_: 1s5e N: [98558] Other proteins in same PDB: d1s5ea_, d1s5eb_ complexed with gal, na |
PDB Entry: 1s5e (more details), 1.9 Å
SCOPe Domain Sequences for d1s5en_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s5en_ b.40.2.1 (N:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
Timeline for d1s5en_: