|  | Class b: All beta proteins [48724] (176 folds) | 
|  | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key | 
|  | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)  | 
|  | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) | 
|  | Protein Cholera toxin [50208] (1 species) barrel, partly opened; n*=5, S*=10 | 
|  | Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries) Uniprot P01556 22-124 | 
|  | Domain d1s5ch_: 1s5c H: [98540] Other proteins in same PDB: d1s5ca_ complexed with na; mutant | 
PDB Entry: 1s5c (more details), 2.5 Å
SCOPe Domain Sequences for d1s5ch_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s5ch_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
Timeline for d1s5ch_: