Lineage for d1s5ch_ (1s5c H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540282Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1540283Protein Cholera toxin [50208] (1 species)
    barrel, partly opened; n*=5, S*=10
  7. 1540284Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
    Uniprot P01556 22-124
  8. 1540395Domain d1s5ch_: 1s5c H: [98540]
    Other proteins in same PDB: d1s5ca_
    complexed with na; mutant

Details for d1s5ch_

PDB Entry: 1s5c (more details), 2.5 Å

PDB Description: cholera holotoxin with an a-subunit y30s mutation, crystal form 1
PDB Compounds: (H:) cholera enterotoxin B-subunit

SCOPe Domain Sequences for d1s5ch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s5ch_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1s5ch_:

Click to download the PDB-style file with coordinates for d1s5ch_.
(The format of our PDB-style files is described here.)

Timeline for d1s5ch_: