SCOPe 2.06: Domain d1s5ab1: 1s5a B:1-140

Lineage for d1s5ab1 (1s5a B:1-140)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)

6. Protein Hypothetical protein YesE [102814] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [102815] (1 PDB entry)

8. Domain d1s5ab1: 1s5a B:1-140 [98526]
   Other proteins in same PDB: d1s5ab2, d1s5ac2, d1s5ad2
   structural genomics
   complexed with act, gol

Details for d1s5ab1

PDB Entry: 1s5a, 1.7 Å

PDB Description: Crystal Structure of Putative Isomerase from Bacillus subtilis

PDB Compounds: (B:) Hypothetical protein yesE

SCOPe Domain Sequences for d1s5ab1:

Sequence; same for both SEQRES and ATOM records:

>d1s5ab1 d.17.4.10 (B:1-140) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]}
mlmnefekacetlrkfmaymlekdmkswtelwdenavfefpyapegspkriegkaaiydy
ikdypkqihlssftaptvyrsadsntviaefqcdghvietglpyrqsyisvietrdgriv
ryrdywnplvvkeafggsfl

Timeline for d1s5ab1:

• d1s5ab1 first appeared in SCOP 1.67, called d1s5ab_
  
• d1s5ab1 was called d1s5ab_ in SCOPe 2.05
  
• d1s5ab1 appears in SCOPe 2.07
  
• d1s5ab1 appears in the current release, SCOPe 2.08