SCOP 1.69: Domain d1s54b_: 1s54 B:

Lineage for d1s54b_ (1s54 B:)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (2 families)

5. Family f.13.1.1: Bacteriorhodopsin-like [81319] (4 proteins)

6. Protein Bacteriorhodopsin [56871] (2 species)
   a light-driven proton pump

7. Species Archaeon Halobacterium salinarum [TaxId:2242] [56873] (52 PDB entries)

8. Domain d1s54b_: 1s54 B: [98524]

Details for d1s54b_

PDB Entry: 1s54, 2.2 Å

PDB Description: thr24ala bacteriorhodopsin

SCOP Domain Sequences for d1s54b_:

Sequence; same for both SEQRES and ATOM records:

>d1s54b_ f.13.1.1 (B:) Bacteriorhodopsin {Archaeon Halobacterium salinarum}
tgrpewiwlalgtalmglgalyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg

Timeline for d1s54b_:

• d1s54b_ first appeared in SCOP 1.67
  
• d1s54b_ appears in SCOP 1.71
  
• d1s54b_ appears in the current release, SCOPe 2.08