![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (3 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H3 [47122] (3 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (20 PDB entries) |
![]() | Domain d1s32e_: 1s32 E: [98416] Other proteins in same PDB: d1s32b_, d1s32c_, d1s32d_, d1s32f_, d1s32g_, d1s32h_ complexed with abu, bal, cl, dib, imt, mn, ogg, pyb |
PDB Entry: 1s32 (more details), 2.05 Å
SCOP Domain Sequences for d1s32e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s32e_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis)} kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas eaylvalfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d1s32e_: