Lineage for d1s2tb_ (1s2t B:)
- Root: SCOP 1.67
Class c: Alpha and beta proteins (a/b) [51349] (130 folds) Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) 
Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (3 proteins)
forms a swapped dimerProtein Phosphoenolpyruvate mutase [51636] (1 species) Species Blue mussel (Mytilus edulis) [TaxId:6550] [51637] (6 PDB entries) 
Domain d1s2tb_: 1s2t B: [98400]
Details for d1s2tb_
PDB Entry: 1s2t (more details), 2 Å
PDB Description: Crystal Structure Of Apo Phosphoenolpyruvate Mutase
SCOP Domain Sequences for d1s2tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s2tb_ c.1.12.7 (B:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis)}
kvkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsneas
wtqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpktns
lhdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayrnag
adailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanhnlr
asvsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpk
SCOP Domain Coordinates for d1s2tb_:
Click to download the PDB-style file with coordinates for d1s2tb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s2tb_:
- d1s2tb_ is new in SCOP 1.67
- d1s2tb_ appears in SCOP 1.69
- d1s2tb_ appears in the current release, SCOPe 2.08
View in 3D
