Lineage for d1s2ta_ (1s2t A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 386143Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 386263Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (3 proteins)
    forms a swapped dimer
  6. 386298Protein Phosphoenolpyruvate mutase [51636] (1 species)
  7. 386299Species Blue mussel (Mytilus edulis) [TaxId:6550] [51637] (6 PDB entries)
  8. 386303Domain d1s2ta_: 1s2t A: [98399]

Details for d1s2ta_

PDB Entry: 1s2t (more details), 2 Å

PDB Description: Crystal Structure Of Apo Phosphoenolpyruvate Mutase

SCOP Domain Sequences for d1s2ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s2ta_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis)}
vkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsneasw
tqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpktnsl
hdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayrnaga
dailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanhnlra
svsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpkn

SCOP Domain Coordinates for d1s2ta_:

Click to download the PDB-style file with coordinates for d1s2ta_.
(The format of our PDB-style files is described here.)

Timeline for d1s2ta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1s2tb_