Class b: All beta proteins [48724] (174 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein Alpha-crustacyanin [63807] (1 species) |
Species European lobster (Homarus gammarus) [TaxId:6707] [63808] (7 PDB entries) |
Domain d1s2pb_: 1s2p B: [98394] C2 subunit complexed with mpd, so4 |
PDB Entry: 1s2p (more details), 1.3 Å
SCOPe Domain Sequences for d1s2pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s2pb_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]} kipnfvvpgkcasvdrnklwaeqtpnrnsyagvwyqfaltnnpyqliekcvrneysfdgk qfvikstgiaydgnllkrngklypnpfgephlsidyensfaaplviletdysnyaclysc idynfgyhsdfsfifsrsanladqyvkkceaafkninvdttrfvktvqgsscpydtqktl
Timeline for d1s2pb_: