Lineage for d1s1qa_ (1s1q A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501596Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 501597Superfamily d.20.1: UBC-like [54495] (3 families) (S)
  5. 501650Family d.20.1.2: UEV domain [75383] (2 proteins)
  6. 501651Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 501652Species Human (Homo sapiens) [TaxId:9606] [75385] (5 PDB entries)
  8. 501653Domain d1s1qa_: 1s1q A: [98351]
    Other proteins in same PDB: d1s1qb_, d1s1qd_

Details for d1s1qa_

PDB Entry: 1s1q (more details), 2 Å

PDB Description: TSG101(UEV) domain in complex with Ubiquitin

SCOP Domain Sequences for d1s1qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens)}
vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp
yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs
dllgliqvmivvfgdeppvfs

SCOP Domain Coordinates for d1s1qa_:

Click to download the PDB-style file with coordinates for d1s1qa_.
(The format of our PDB-style files is described here.)

Timeline for d1s1qa_: