Lineage for d1s1qa_ (1s1q A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164133Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2164134Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2164459Family d.20.1.2: UEV domain [75383] (3 protein domains)
  6. 2164460Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 2164461Species Human (Homo sapiens) [TaxId:9606] [75385] (13 PDB entries)
  8. 2164467Domain d1s1qa_: 1s1q A: [98351]
    Other proteins in same PDB: d1s1qb_, d1s1qd_
    complexed with acy, cu, so4

Details for d1s1qa_

PDB Entry: 1s1q (more details), 2 Å

PDB Description: TSG101(UEV) domain in complex with Ubiquitin
PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d1s1qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
vsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvp
yrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqs
dllgliqvmivvfgdeppvfs

SCOPe Domain Coordinates for d1s1qa_:

Click to download the PDB-style file with coordinates for d1s1qa_.
(The format of our PDB-style files is described here.)

Timeline for d1s1qa_: