Lineage for d1s1qc_ (1s1q C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2507728Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2507729Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2508084Family d.20.1.2: UEV domain [75383] (3 protein domains)
  6. 2508085Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 2508086Species Human (Homo sapiens) [TaxId:9606] [75385] (13 PDB entries)
  8. 2508093Domain d1s1qc_: 1s1q C: [98353]
    Other proteins in same PDB: d1s1qb_, d1s1qd_
    complexed with acy, cu, so4

Details for d1s1qc_

PDB Entry: 1s1q (more details), 2 Å

PDB Description: TSG101(UEV) domain in complex with Ubiquitin
PDB Compounds: (C:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d1s1qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s1qc_ d.20.1.2 (C:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
sesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipvpy
rgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsd
llgliqvmivvfgdeppvf

SCOPe Domain Coordinates for d1s1qc_:

Click to download the PDB-style file with coordinates for d1s1qc_.
(The format of our PDB-style files is described here.)

Timeline for d1s1qc_: