Lineage for d1s0yk_ (1s0y K:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2960764Family d.80.1.1: 4-oxalocrotonate tautomerase-like [55332] (5 proteins)
    dimer of beta-alpha-beta subunits: may assemble further in hexamer (trimer of the dimers)
  6. 2960965Protein Trans-3-chloroacrylic acid dehalogenase alpha-subunit, CaaD1 [103094] (1 species)
    forms heterohexamer with beta-subunit
  7. 2960966Species Pseudomonas pavonaceae [TaxId:47881] [103095] (1 PDB entry)
  8. 2960972Domain d1s0yk_: 1s0y K: [98324]
    Other proteins in same PDB: d1s0yb_, d1s0yd_, d1s0yf_, d1s0yh_, d1s0yj_, d1s0yl_
    complexed with mla

Details for d1s0yk_

PDB Entry: 1s0y (more details), 2.3 Å

PDB Description: the structure of trans-3-chloroacrylic acid dehalogenase, covalently inactivated by the mechanism-based inhibitor 3-bromopropiolate at 2.3 angstrom resolution
PDB Compounds: (K:) Alpha-subunit of trans-3-chloroacrylic acid dehalogenase

SCOPe Domain Sequences for d1s0yk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0yk_ d.80.1.1 (K:) Trans-3-chloroacrylic acid dehalogenase alpha-subunit, CaaD1 {Pseudomonas pavonaceae [TaxId: 47881]}
pmiscdmrygrtdeqkralsagllrviseatgepreniffviregsginfvehgehlpdy
v

SCOPe Domain Coordinates for d1s0yk_:

Click to download the PDB-style file with coordinates for d1s0yk_.
(The format of our PDB-style files is described here.)

Timeline for d1s0yk_: