Lineage for d1s0yf_ (1s0y F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2526467Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2526468Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2526469Family d.80.1.1: 4-oxalocrotonate tautomerase-like [55332] (5 proteins)
    dimer of beta-alpha-beta subunits: may assemble further in hexamer (trimer of the dimers)
  6. 2526616Protein Trans-3-chloroacrylic acid dehalogenase beta-subunit, CaaD2 [103096] (1 species)
    forms heterohexamer with alpha-subunit
  7. 2526617Species Pseudomonas pavonaceae [TaxId:47881] [103097] (1 PDB entry)
  8. 2526620Domain d1s0yf_: 1s0y F: [98319]
    Other proteins in same PDB: d1s0ya_, d1s0yc_, d1s0ye_, d1s0yg_, d1s0yi_, d1s0yk_
    complexed with mla

Details for d1s0yf_

PDB Entry: 1s0y (more details), 2.3 Å

PDB Description: the structure of trans-3-chloroacrylic acid dehalogenase, covalently inactivated by the mechanism-based inhibitor 3-bromopropiolate at 2.3 angstrom resolution
PDB Compounds: (F:) Beta-subunit of trans-3-chloroacrylic acid dehalogenase

SCOPe Domain Sequences for d1s0yf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0yf_ d.80.1.1 (F:) Trans-3-chloroacrylic acid dehalogenase beta-subunit, CaaD2 {Pseudomonas pavonaceae [TaxId: 47881]}
pfiechiatglsvarkqqlirdvidvtnksigsdpkiinvllvehaeanmsisgrih

SCOPe Domain Coordinates for d1s0yf_:

Click to download the PDB-style file with coordinates for d1s0yf_.
(The format of our PDB-style files is described here.)

Timeline for d1s0yf_: