| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.98: BLIP-like [55647] (2 superfamilies) alpha(2)-beta(4); 2 layers: alpha/beta |
Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families) ![]() |
| Family d.98.1.1: beta-lactamase-inhibitor protein, BLIP [55649] (2 proteins) duplication: consists of two clear structural repeats each having this fold automatically mapped to Pfam PF07467 |
| Protein beta-lactamase-inhibitor protein, BLIP [55650] (1 species) |
| Species Streptomyces clavuligerus [TaxId:1901] [55651] (2 PDB entries) |
| Domain d1s0wd_: 1s0w D: [98312] Other proteins in same PDB: d1s0wa_, d1s0wb_ complexed with ca |
PDB Entry: 1s0w (more details), 2.3 Å
SCOPe Domain Sequences for d1s0wd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0wd_ d.98.1.1 (D:) beta-lactamase-inhibitor protein, BLIP {Streptomyces clavuligerus [TaxId: 1901]}
agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts
aaadakvdsksqekllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
stagvtlslscfdvdgysstgayrgsahlwftdgvlqgkrqwdlv
Timeline for d1s0wd_: