Lineage for d1s0wd_ (1s0w D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967139Fold d.98: BLIP-like [55647] (2 superfamilies)
    alpha(2)-beta(4); 2 layers: alpha/beta
  4. 2967140Superfamily d.98.1: beta-lactamase-inhibitor protein, BLIP [55648] (2 families) (S)
  5. 2967141Family d.98.1.1: beta-lactamase-inhibitor protein, BLIP [55649] (2 proteins)
    duplication: consists of two clear structural repeats each having this fold
    automatically mapped to Pfam PF07467
  6. 2967142Protein beta-lactamase-inhibitor protein, BLIP [55650] (1 species)
  7. 2967143Species Streptomyces clavuligerus [TaxId:1901] [55651] (2 PDB entries)
  8. 2967147Domain d1s0wd_: 1s0w D: [98312]
    Other proteins in same PDB: d1s0wa_, d1s0wb_
    complexed with ca

Details for d1s0wd_

PDB Entry: 1s0w (more details), 2.3 Å

PDB Description: 1b lactamse/ b lactamase inhibitor
PDB Compounds: (D:) Beta-lactamase inhibitory protein

SCOPe Domain Sequences for d1s0wd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0wd_ d.98.1.1 (D:) beta-lactamase-inhibitor protein, BLIP {Streptomyces clavuligerus [TaxId: 1901]}
agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts
aaadakvdsksqekllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
stagvtlslscfdvdgysstgayrgsahlwftdgvlqgkrqwdlv

SCOPe Domain Coordinates for d1s0wd_:

Click to download the PDB-style file with coordinates for d1s0wd_.
(The format of our PDB-style files is described here.)

Timeline for d1s0wd_: