Lineage for d1s0ua3 (1s0u A:34-229)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1164027Protein Initiation factor eIF2 gamma subunit, N-terminal (G) domain [75204] (3 species)
    includes rubredoxin-like zinc finger insert domain, res. 56-83, similar that of the Nop10-like family (144211)
  7. 1164028Species Methanococcus jannaschii [TaxId:2190] [102365] (1 PDB entry)
  8. 1164029Domain d1s0ua3: 1s0u A:34-229 [98304]
    Other proteins in same PDB: d1s0ua1, d1s0ua2
    structural genomics
    complexed with zn

Details for d1s0ua3

PDB Entry: 1s0u (more details), 2.4 Å

PDB Description: eif2gamma apo
PDB Compounds: (A:) Translation initiation factor 2 gamma subunit

SCOPe Domain Sequences for d1s0ua3:

Sequence, based on SEQRES records: (download)

>d1s0ua3 c.37.1.8 (A:34-229) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Methanococcus jannaschii [TaxId: 2190]}
sqaevnigmvghvdhgktsltkaltgvwtdrhseelrrgisirlgyadceirkcpqcgty
ttkprcpnclaeteflrrvsfvdspghetlmatmlsgaslmdgailviaanepcpqpqtk
ehlmaleilgidkiiivqnkidlvdekqaeenyeqikefvkgtiaenapiipisahhean
idvllkaiqdfiptpk

Sequence, based on observed residues (ATOM records): (download)

>d1s0ua3 c.37.1.8 (A:34-229) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Methanococcus jannaschii [TaxId: 2190]}
sqaevnigmvghvdhgktsltkaltgvwtdrgisirlgyadceirkcpqcgtyttkprcp
nclaeteflrrvsfvdspghetlmatmlsgaslmdgailviaanepcpqpqtkehlmale
ilgidkiiivqnkidlvdekqaeenyeqikefvkgtiaenapiipinidvllkaiqdfip
tpk

SCOPe Domain Coordinates for d1s0ua3:

Click to download the PDB-style file with coordinates for d1s0ua3.
(The format of our PDB-style files is described here.)

Timeline for d1s0ua3: