SCOPe 2.07: Domain d1s0pb_: 1s0p B:

Lineage for d1s0pb_ (1s0p B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.192: N-terminal domain of adenylylcyclase associated protein, CAP [101277] (1 superfamily)
   6 helices: bundle; left-handed twist, up-and-down topology

4. Superfamily a.192.1: N-terminal domain of adenylylcyclase associated protein, CAP [101278] (2 families)
   automatically mapped to Pfam PF01213

5. Family a.192.1.1: N-terminal domain of adenylylcyclase associated protein, CAP [101279] (1 protein)

6. Protein N-terminal domain of adenylylcyclase associated protein, CAP [101280] (1 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101281] (3 PDB entries)

8. Domain d1s0pb_: 1s0p B: [98301]
   complexed with mg

Details for d1s0pb_

PDB Entry: 1s0p, 1.4 Å

PDB Description: Structure of the N-Terminal Domain of the Adenylyl Cyclase-Associated Protein (CAP) from Dictyostelium discoideum.

PDB Compounds: (B:) Adenylyl cyclase-associated protein

SCOPe Domain Sequences for d1s0pb_:

Sequence; same for both SEQRES and ATOM records:

>d1s0pb_ a.192.1.1 (B:) N-terminal domain of adenylylcyclase associated protein, CAP {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
svkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqskkpsqetll
elikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgphvaemrgsae
fytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggdaksat

Timeline for d1s0pb_:

• d1s0pb_ first appeared in SCOP 1.67
  
• d1s0pb_ appears in SCOPe 2.06
  
• d1s0pb_ appears in the current release, SCOPe 2.08