Class a: All alpha proteins [46456] (285 folds) |
Fold a.192: N-terminal domain of adenylylcyclase associated protein, CAP [101277] (1 superfamily) 6 helices: bundle; left-handed twist, up-and-down topology |
Superfamily a.192.1: N-terminal domain of adenylylcyclase associated protein, CAP [101278] (1 family) automatically mapped to Pfam PF01213 |
Family a.192.1.1: N-terminal domain of adenylylcyclase associated protein, CAP [101279] (1 protein) |
Protein N-terminal domain of adenylylcyclase associated protein, CAP [101280] (1 species) |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [101281] (2 PDB entries) |
Domain d1s0pb_: 1s0p B: [98301] complexed with mg |
PDB Entry: 1s0p (more details), 1.4 Å
SCOPe Domain Sequences for d1s0pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s0pb_ a.192.1.1 (B:) N-terminal domain of adenylylcyclase associated protein, CAP {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} svkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqskkpsqetll elikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgphvaemrgsae fytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggdaksat
Timeline for d1s0pb_: