Lineage for d1s0ga3 (1s0g A:1-533)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529349Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2529350Protein Botulinum neurotoxin [55513] (4 species)
  7. 2529388Species Clostridium botulinum, serotype B [TaxId:1491] [55515] (17 PDB entries)
  8. 2529400Domain d1s0ga3: 1s0g A:1-533 [98287]
    Other proteins in same PDB: d1s0ga1, d1s0ga2, d1s0ga4

Details for d1s0ga3

PDB Entry: 1s0g (more details), 2.6 Å

PDB Description: Crystal structure of botulinum neurotoxin type B apo form
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d1s0ga3:

Sequence, based on SEQRES records: (download)

>d1s0ga3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmcksvkapgicidvdnedlffiadknsfsddlsknerieyntqsny
iendfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

Sequence, based on observed residues (ATOM records): (download)

>d1s0ga3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
eeiskehlavykiqmcksvpgicidvdnedlffiadknsfsddlsknerieyntqsnyie
ndfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftde

SCOPe Domain Coordinates for d1s0ga3:

Click to download the PDB-style file with coordinates for d1s0ga3.
(The format of our PDB-style files is described here.)

Timeline for d1s0ga3: