Lineage for d1s0ga1 (1s0g A:862-1079)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2374399Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 protein domains)
    automatically mapped to Pfam PF07953
  6. 2374400Protein Botulinum neurotoxin [49959] (2 species)
  7. 2374414Species Clostridium botulinum, serotype B [TaxId:1491] [49961] (14 PDB entries)
  8. 2374426Domain d1s0ga1: 1s0g A:862-1079 [98285]
    Other proteins in same PDB: d1s0ga2, d1s0ga3, d1s0ga4

Details for d1s0ga1

PDB Entry: 1s0g (more details), 2.6 Å

PDB Description: Crystal structure of botulinum neurotoxin type B apo form
PDB Compounds: (A:) botulinum neurotoxin type b

SCOPe Domain Sequences for d1s0ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s0ga1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
niilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqniifnsv
fldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingkt
ksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeiif
kldgdidrtqfiwmkyfsifntelsqsnieerykiqsy

SCOPe Domain Coordinates for d1s0ga1:

Click to download the PDB-style file with coordinates for d1s0ga1.
(The format of our PDB-style files is described here.)

Timeline for d1s0ga1: