Lineage for d1ry7b1 (1ry7 B:150-248)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2364875Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2364958Protein Fibroblast growth factor receptor, FGFR [49179] (4 species)
  7. 2365019Species Human (Homo sapiens), FGFR3c [TaxId:9606] [101514] (1 PDB entry)
  8. 2365020Domain d1ry7b1: 1ry7 B:150-248 [98092]
    Other proteins in same PDB: d1ry7a_

Details for d1ry7b1

PDB Entry: 1ry7 (more details), 3.2 Å

PDB Description: Crystal Structure of the 3 Ig form of FGFR3c in complex with FGF1
PDB Compounds: (B:) Fibroblast growth factor receptor 3

SCOPe Domain Sequences for d1ry7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ry7b1 b.1.1.4 (B:150-248) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR3c [TaxId: 9606]}
apywtrpermdkkllavpaantvrfrcpaagnptpsiswlkngrefrgehriggiklrhq
qwslvmesvvpsdrgnytcvvenkfgsirqtytldvler

SCOPe Domain Coordinates for d1ry7b1:

Click to download the PDB-style file with coordinates for d1ry7b1.
(The format of our PDB-style files is described here.)

Timeline for d1ry7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ry7b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ry7a_