Lineage for d1ry4a_ (1ry4 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558451Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 558452Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
    peptide-binding domain
  5. 558453Family b.36.1.1: PDZ domain [50157] (35 proteins)
    Pfam 00595
  6. 558494Protein GTPase-binding domain of the cell polarity protein par6 (Par-6B) [89315] (2 species)
  7. 558495Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101716] (3 PDB entries)
  8. 558498Domain d1ry4a_: 1ry4 A: [98085]

Details for d1ry4a_

PDB Entry: 1ry4 (more details)

PDB Description: nmr structure of the crib-pdz module of par-6

SCOP Domain Sequences for d1ry4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ry4a_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster)}
gsktkapsisiphdfrqvsaiidvdivpethrrvrllkhgsdkplgfyirdgtsvrvtas
glekqpgifisrlvpgglaestgllavndevievngievagktldqvtdmmvanssnlii
tvkpanqr

SCOP Domain Coordinates for d1ry4a_:

Click to download the PDB-style file with coordinates for d1ry4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ry4a_: