SCOPe 2.04: Domain d1rxjc_: 1rxj C:

Lineage for d1rxjc_ (1rxj C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (123 PDB entries)

8. Domain d1rxjc_: 1rxj C: [98031]
   complexed with bni; mutant

Details for d1rxjc_

PDB Entry: 1rxj, 1.14 Å

PDB Description: Crystal structure of streptavidin mutant (M2) where the L3,4 loop was replace by that of avidin

PDB Compounds: (C:) streptavidin

SCOPe Domain Sequences for d1rxjc_:

Sequence, based on SEQRES records:

>d1rxjc_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesatsneikryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Sequence, based on observed residues (ATOM records):

>d1rxjc_ b.61.1.1 (C:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyeskryvltgrydsapatdgsgtalgwtvawkn
nyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Timeline for d1rxjc_:

• d1rxjc_ first appeared in SCOP 1.67
  
• d1rxjc_ appears in SCOPe 2.03
  
• d1rxjc_ appears in SCOPe 2.05
  
• d1rxjc_ appears in the current release, SCOPe 2.08