![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
![]() | Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) ![]() duplication: contains two structural repeats |
![]() | Family f.43.1.1: Chlorophyll a-b binding protein [103512] (2 proteins) |
![]() | Protein Chlorophyll a-b binding protein [103513] (1 species) part of chloroplast major light-harvesting complex; see also low-resolution structure of pea protein, PDB entry 1VCR |
![]() | Species Spinach (Spinacia oleracea) [TaxId:3562] [103514] (1 PDB entry) |
![]() | Domain d1rwtf_: 1rwt F: [97997] complexed with bng, chl, cla, dgd, lhg, lut, na, nex, xat |
PDB Entry: 1rwt (more details), 2.72 Å
SCOPe Domain Sequences for d1rwtf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rwtf_ f.43.1.1 (F:) Chlorophyll a-b binding protein {Spinach (Spinacia oleracea) [TaxId: 3562]} spwygpdrvkylgpfsgespsyltgefpgdygwdtaglsadpetfaknrelevihcrwam lgalgcvfpellarngvkfgeavwfkagsqifseggldylgnpslvhaqsilaiwacqvi lmgavegyriaggplgevvdplypggsfdplgladdpeafaelkvkeikngrlamfsmfg ffvqaivtgkgplenladhladpvnnnawnfatnfvpgk
Timeline for d1rwtf_: