Lineage for d1rw7a_ (1rw7 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1589127Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1589289Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 1589370Protein Hypothetical protein Ydr533Cp [102253] (1 species)
    contains a buried Cys-His-Glu triad within one subunit
  7. 1589371Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102254] (4 PDB entries)
  8. 1589376Domain d1rw7a_: 1rw7 A: [97963]

Details for d1rw7a_

PDB Entry: 1rw7 (more details), 1.8 Å

PDB Description: Crystal Structure of YDR533Cp
PDB Compounds: (A:) YDR533Cp

SCOPe Domain Sequences for d1rw7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rw7a_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
apkkvllaltsyndvfysdgaktgvfvvealhpfntfrkegfevdfvsetgkfgwdehsl
akdflngqdetdfknkdsdfnktlakiktpkevnaddyqiffasaghgtlfdypkakdlq
diaseiyanggvvaavchgpaifdgltdkktgrpliegksitgftdvgetilgvdsilka
knlatvedvakkygakylapvgpwddysitdgrlvtgvnpasahstavrsidalk

SCOPe Domain Coordinates for d1rw7a_:

Click to download the PDB-style file with coordinates for d1rw7a_.
(The format of our PDB-style files is described here.)

Timeline for d1rw7a_: