Lineage for d1rv6y_ (1rv6 Y:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753887Protein Second domain of the Flt-1 receptor [49188] (1 species)
  7. 2753888Species Human (Homo sapiens) [TaxId:9606] [49189] (6 PDB entries)
  8. 2753892Domain d1rv6y_: 1rv6 Y: [97915]
    Other proteins in same PDB: d1rv6v_, d1rv6w_
    complexed with b3p

Details for d1rv6y_

PDB Entry: 1rv6 (more details), 2.45 Å

PDB Description: Crystal Structure of PlGF in Complex with Domain 2 of VEGFR1
PDB Compounds: (Y:) FLT1 protein

SCOPe Domain Sequences for d1rv6y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rv6y_ b.1.1.4 (Y:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]}
rpfvemyseipeiihmtegrelvipcrvtspnitvtlkkfpldtlipdgkriiwdsrkgf
iisnatykeiglltceatvnghlyktnylthr

SCOPe Domain Coordinates for d1rv6y_:

Click to download the PDB-style file with coordinates for d1rv6y_.
(The format of our PDB-style files is described here.)

Timeline for d1rv6y_: