Lineage for d1rsoa_ (1rso A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545897Fold a.194: L27 domain [101287] (1 superfamily)
    6 helices, heterodimer of 3-helical domains
  4. 545898Superfamily a.194.1: L27 domain [101288] (1 family) (S)
  5. 545899Family a.194.1.1: L27 domain [101289] (4 proteins)
  6. 545912Protein Presynaptic protein sap97 [101294] (1 species)
  7. 545913Species Rat (Rattus norvegicus) [TaxId:10116] [101295] (1 PDB entry)
  8. 545914Domain d1rsoa_: 1rso A: [97811]
    Other proteins in same PDB: d1rsob_, d1rsod_

Details for d1rsoa_

PDB Entry: 1rso (more details)

PDB Description: hetero-tetrameric l27 (lin-2, lin-7) domain complexes as organization platforms of supra-molecular assemblies

SCOP Domain Sequences for d1rsoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsoa_ a.194.1.1 (A:) Presynaptic protein sap97 {Rat (Rattus norvegicus)}
rkqdtqralhlleeyrsklsqtedrqlrssiervisifqsnlfqalidiqefyevtlldn

SCOP Domain Coordinates for d1rsoa_:

Click to download the PDB-style file with coordinates for d1rsoa_.
(The format of our PDB-style files is described here.)

Timeline for d1rsoa_: